Web Analysis for Stephaniefiermanmarketingdaily - stephaniefiermanmarketingdaily.com
Marketing guru Stephanie Fierman blogs about the art and science of connecting with consumers.
2.00
Rating by CuteStat
stephaniefiermanmarketingdaily.com is 1 decade 6 years old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, stephaniefiermanmarketingdaily.com is SAFE to browse.
PageSpeed Score
63
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Good |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | 15 | Total Images: | 13 |
Google Adsense: | Not Applicable | Google Analytics: | UA-7164021-1 |
Websites Hosted on Same IP (i.e. 68.178.254.126)
CAT ID TAGS BOUTIQUE Fancy RHINESTONE COLLARS, Designer Crystal pet ID
- cat-id-tags.com
Not Applicable
$
8.95
Baltimore Pest Control Services | Bed Bug Control | AllPest Exterminat
- allpest.net
AllPest Termite & Pest - Controlling Termites & Pests since 1973 - WDI-O Credentialed Termite Inspector
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Mon, 23 Jun 2014 17:51:39 GMT
Server: Apache
X-Pingback: http://www.stephaniefiermanmarketingdaily.com/xmlrpc.php
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Date: Mon, 23 Jun 2014 17:51:39 GMT
Server: Apache
X-Pingback: http://www.stephaniefiermanmarketingdaily.com/xmlrpc.php
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns53.domaincontrol.com | 97.74.106.27 | United States of America | |
ns54.domaincontrol.com | 173.201.74.27 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
stephaniefiermanmarketingdaily.com | A | 584 |
IP: 68.178.254.126 |
stephaniefiermanmarketingdaily.com | NS | 3599 |
Target: ns54.domaincontrol.com |
stephaniefiermanmarketingdaily.com | NS | 3599 |
Target: ns53.domaincontrol.com |
stephaniefiermanmarketingdaily.com | SOA | 3599 |
MNAME: ns53.domaincontrol.com RNAME: dns.jomax.net Serial: 2008031800 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 3600 |
stephaniefiermanmarketingdaily.com | MX | 3599 |
Target: smtp.secureserver.net |
stephaniefiermanmarketingdaily.com | MX | 3599 |
Priority: 10 Target: mailstore1.secureserver.net |
Full WHOIS Lookup
Domain Name: STEPHANIEFIERMANMARKETINGDAILY.COM
Registrar URL: http://www.godaddy.com
Registrant Name: Stephanie Fierman
Registrant Organization:
Name Server: NS53.DOMAINCONTROL.COM
Name Server: NS54.DOMAINCONTROL.COM
DNSSEC: unsigned
For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=STEPHANIEFIERMANMARKETINGDAILY.COM
The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.
Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.
Registrar URL: http://www.godaddy.com
Registrant Name: Stephanie Fierman
Registrant Organization:
Name Server: NS53.DOMAINCONTROL.COM
Name Server: NS54.DOMAINCONTROL.COM
DNSSEC: unsigned
For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=STEPHANIEFIERMANMARKETINGDAILY.COM
The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.
Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.